PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00364.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 156aa    MW: 17684.7 Da    PI: 6.6185
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00364.1_g00004.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.73.2e-1058102650
                              HHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   6 rerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                              + rr   NReA r++R++Kka+++ Le++vk L++ N+ L  +l+
  Rsa1.0_00364.1_g00004.1  58 NKRRSCGNREAVRKYREKKKARTAYLEDEVKRLKSMNEFLLRKLQ 102
                              5788899*******************************9998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.1E-652120IPR004827Basic-leucine zipper domain
PfamPF077161.8E-1455102IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.86455121IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.52E-757103No hitNo description
Gene3DG3DSA:1.20.5.1701.5E-1158121No hitNo description
CDDcd146861.14E-965103No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042538Biological Processhyperosmotic salinity response
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 156 aa     Download sequence    Send to blast
MDEEEVEAWA RASGGCSHTH SCNPPGPENA SHSHTCFHTH THLIIPDSQE NGYSDGSNKR  60
RSCGNREAVR KYREKKKART AYLEDEVKRL KSMNEFLLRK LQSQAIVEAE IIRLRTLLAE  120
MQGTIDDELG GFSFQKQCNG SDFVFKEGDV SFCLVY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013631502.11e-100PREDICTED: uncharacterized protein LOC106337035
SwissprotQ8GTS13e-78BZP24_ARATH; Basic leucine zipper 24
TrEMBLA0A0D3BYL51e-107A0A0D3BYL5_BRAOL; Uncharacterized protein
STRINGBra033464.1-P5e-99(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM151721518
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51960.16e-68basic leucine zipper 24